FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mG.

https://www.multilinkx.com/web/image/product.template/39757/image_1920?unique=3006b3e
(0 review)

2,249.00 € 2249.0 EUR 2,249.00 € VAT Excluded

2,249.00 VAT Excluded

Not Available For Sale

    This combination does not exist.

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days


    Website URL: /shop/0399-csb-dt0293-500mg-fvnqhlsgshlvealylvsgergffytpka-synthetic-peptide-purity-98-500mg-39757
    Internal Reference: 0399-CSB-DT0293-500mG.

    Your Dynamic Snippet will be displayed here... This message is displayed because you did not provided both a filter and a template to use.